PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00170g00063.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 281aa    MW: 31574.4 Da    PI: 9.2579
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00170g00063.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.64.4e-31176229255
                   G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               pr+rWt++LH+rF++ave LGG+e+AtPk++lelm+ k+Ltl+hvkSHLQ+YR+
  Peaxi162Scf00170g00063.1 176 PRMRWTSTLHARFLHAVELLGGHERATPKSVLELMDAKDLTLAHVKSHLQMYRT 229
                               9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.27E-15173229IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-27174229IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-23176229IPR006447Myb domain, plants
PfamPF002494.7E-7177228IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MELFPAQPDL SLKISPPNIK PSSAWKRTTT SSCEDRNIDI EFWRRAVDNN IHSSSNCFEL  60
SLSNIPTRPN SCEPDSAHHS DHRQKYILQQ SNFQIHNQNQ GLSPEFGFLR GIPVYHQNSL  120
SQQQLDSTTT SATFPRTSLL ACSNINNNNK SIINSSGLLR SRFMSRFPSK RSMRAPRMRW  180
TSTLHARFLH AVELLGGHER ATPKSVLELM DAKDLTLAHV KSHLQMYRTV KTTDRAAAVA  240
SSGLSEVLDN GSSGDTSEDL MLETQYLRNS EFAVQGIGNM R
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016573194.12e-98PREDICTED: probable transcription factor KAN2
TrEMBLB9RZ095e-93B9RZ09_RICCO; Transcription factor, putative
STRINGPOPTR_0003s09490.12e-90(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27382255
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.13e-53G2-like family protein